Anti-SCARB1/Sr Bi Picoband Antibody

• Catalog number
  PB9502
• Price
  Please ask
• Size
  100µg/vial

• Clonality
  Polyclonal
• Sample Size Available
  30ug for $99, contact us for details
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.
• Form
  Lyophilized
• Purification
  Immunogen affinity purified.
• Storage Transport Conditions
  At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
• Cross reactivity
  No cross reactivity with other proteins
• Ig Type
  N/A
• Reconstitution
  Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Application Details
  Western blot, 0.1-0.5µg/ml, Mouse, RatImmunohistochemistry(Frozen Section), 0.5-1µg/ml, Mouse Immunocytochemistry, 0.5-1µg/ml, Mouse Flow Cytometry, 1-3µg/1x106 cells, Mouse
• Applications
  Flow Cytometry, IHC, ICC, WB
• Reactivity
  Mouse, Rat
• Product Datasheet
  www.bosterbio.com/datasheet.php?sku=PB9502
• Description
  This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SCARB1/Sr   Picoband  
• Gene symbol
  SCARB1
• Short name
  Anti-SCARB1/Sr Bi Picoband Antibody
• Technique
  Antibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for
• Host
  Rabbit
• Isotype
  N/A
• Alternative name
  Antibody toscavenger receptor class B, member 1/Sr Bi Picoband (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  scavenger receptor class B, member 1, CD36L1 and CLA-1 and CLA1 and HDLQTL6 and SR-BI and SRB1, SCARB1 and IDBG-63952 and ENSG00000073060 and 949, high-density lipoprotein particle receptor activity, Cell surfaces, Scarb1 and IDBG-201281 and ENSMUSG00000037936 and 20778, SCARB1 and IDBG-631911 and ENSBTAG00000014269 and 282346

Gene info

• Identity
  HGNC:1664
• Gene
  SCARB1
• Long gene name
  scavenger receptor class B member 1
• Synonyms gene
  • CD36L1
• Synonyms gene name
  • CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1
  • scavenger receptor class B, member 1
• Synonyms
  • SRB1
  • CLA-1
  • CLA1
  • SR-BI
• GenBank acession
  • Z22555
• Locus
  12q24.31
• Discovery year
  1994-09-06
• Entrez gene record
  949
• Pubmed identfication
  • 7689561
• RefSeq identity
  • NM_005505
• Classification
  • Scavenger receptors
• VEGA ID
  OTTHUMG00000168544

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products