Anti-IFNGR1/Cd119 Picoband Antibody

  • Catalog number
    A01716-2
  • Price
    Please ask
  • Size
    100µg/vial
  • Clonality
    Polyclonal
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFH), different from the related mouse sequence by eighteen amino acids.
  • Form
    Lyophilized
  • Purification
    Immunogen affinity purified.
  • Storage Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross reactivity
    No cross reactivity with other proteins.
  • Ig Type
    N/A
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Western blot, 0.1-0.5µg/ml, Human
  • Applications
    WB
  • Reactivity
    Human
  • Product Datasheet
    www.bosterbio.com/datasheet.php?sku=A01716-2
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    IFNGR1
  • Short name
    Anti-IFNGR1/Cd119 Picoband Antibody
  • Technique
    Antibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for
  • Host
    Rabbit
  • Isotype
    N/A
  • Alternative name
    Antibody tointerferon g receptor 1/Cd119 Picoband (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    interferon gamma receptor 1, CD119 and IFNGR and IMD27A and IMD27B, IFNGR1 and IDBG-97020 and ENSG00000027697 and 3459, cytokine binding, Plasma membranes, Ifngr1 and IDBG-135936 and ENSMUSG00000020009 and 15979, BT.49564 and IDBG-633678 and ENSBTAG00000012544 and 508619
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The assay of INTERFERON-GAMMA released from lymphocytes after their exposure to a specific test antigen, to check for IMMUNOLOGIC MEMORY resulting from a previous exposure to the antigen. The amount of interferon-gamma released is usually assayed by an ENZYME-LINKED IMMUNOSORBENT ASSAY.
  • Tree numbers
    • E01.370.225.812.453
    • E05.200.812.453
    • E05.478.594.475
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee