Native Human Serum Aminopeptidase N (ANPEP) (Native Protein)
#
-
Catalog number30 801 003
-
Price:
-
Size200 µg/ 1 ml
-
-
Protein typeNative
-
Protein subtypeEC 3.4.11.2
-
Protein familyAminopeptidase
-
Protein descriptionANPEP plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. May play a critical role in the pathogenesis of cholesterol gallstone disease. May be involved in the metabolism of regulatory peptides of diverse cell types, responsible for the processing of peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines. Found to cleave antigen peptides bound to major histocompatibility complex class II molecules of presenting cells and to degrade neurotransmitters at synaptic junctions. Is also implicated as a regulator of IL-8 bioavailability in the endometrium, and therefore may contribute to the regulation of angiogenesis. Is used as a marker for acute myeloid leukemia and plays a role in tumor invasion. In case of human coronavirus 229E (HCoV-229E) infection, serves as receptor for HCoV-229E spike glycoprotein. Mediates as well human cytomegalovirus (HCMV) infection.
-
Research area interestsDiseases associated with ANPEP include Tetrasomy 21 and Acute Leukemia. Among its related pathways are Hematopoietic cell lineage and Transport to the Golgi and subsequent modification
-
Package formliquid
-
Tested applicationsScreening of inhibitors; Characterization of structure and function; Target for angiogenesis
-
Other namesANPEP; Myeloid Plasma Membrane Glycoprotein CD13, Membrane Alanyl Aminopeptidase
-
Peptide sequenceMAKGFYISKSLGILGILLGVAAVCTIIALSVVYSQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARKSFPCFDEPAMKAEFNITLIHPKDLTALSNMLPKGPSTPLPEDPNWNVTEFHTTPKMSTYLLAFIVSEFDYVEKQASNGVLI RIWARPSAIAAGHGDYALNVTGPILNFFAGHYDTPYPLPKSDQIGLPDFNAGAMENWGLVTYRENSLLFDPLSSSSSNKERVVTVIAHELAHQWFGNLVTIEWWNDLWLNEGFASYVEYLGADYAEPTWNLKDLMVLNDVYRVMAVDALASSHPLSTPASEINTPAQISELFDAISYSKGASVLRMLSSFLSEDVFKQGLASYLHTFAYQNTIYLNLWDHLQEAVNNRSIQLPTTVRDIMNRWTLQMGFPVITVDTSTGTLSQEHFLLDPDSNVTRPSEFNYVWIVPITSIRDGRQQQDY WLIDVRAQNDLFSTSGNEWVLLNLNVTGYYRVNYDEENWRKIQTQLQRDHSAIPVINRAQIINDAFNLASAHKVPVTLALNNTLFLIEERQYMPWEAALSSLSYFKLMFDRSEVYGPMKNYLKKQVTPLFIHFRNNTNNWREIPENLMDQYSEVNAISTACSNGVPECEEMVSGLFKQWMENPNNNPIHPNLRSTVYCNAIAQGGEEEWDFAWEQFRNATLVNEADKLRAALACSKELWILNRYLSYTLNPDLIRKQDATSTIISITNNVIGQGLVWDFVQSNWKKLFNDYGGGSFSFSN LIQAVTRRFSTEYELQQLEQFKKDNEETGFGSGTRALEQALEKTKANIKWVKENKEVVLQWFTENSK
-
Available target modificationYes
-
Expression systemHuman Serum
-
Product Subtypefull length
-
Active formYes
-
Taguntagged
-
Contents20 mM Tris-HCl, pH 7.4, 500 mM NaCl, 1mM CaCl2
-
Protein purity>90%
-
Molecular weight110-130 kDa
-
UniProt numberP15144
-
Gene number290
-
AbbreviationANPEP
-
Full namealanyl aminopeptidase, membrane
-
Other desciptionAminopeptidase N is prepared from human serum certified to be negative for HBsAg and for antibodies to HIV and HCV.
-
PurificationMentioned in the data sheet
-
PubMed citationsSee the data sheet
-
WarningsFor Research Use only.
-
Shipping conditionsdry ice
-
Storage conditionStore at -70°C
-
Technical datasheetContact us to receive the datasheet
-
PropertiesHuman proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
DescriptionAzide Free Serum for cell culture FBS fetal bovine serum. Filtered serum for sterility. The polyclonal serum contains no red or white blood cells or clotting factors; it is the blood plasma not including the fibrinogens. Serum includes all proteins and antibodies not used in blood clotting (coagulation) and all the electrolytes, antibodies, antigens, hormones, and any exogenous substances like drugs and microorganisms. Plasmas on request.
-
GroupSera
-
AboutSerum should be stored at +5°C
-
Gene target
-
Gene symbolANPEP
-
Short nameNative Serum Aminopeptidase N (ANPEP) (Native Protein)
-
Techniqueserum
-
SpeciesHomo sapiens, Humans
-
Alternative nameNative H. sapiens blood serum Aminopeptidase N (ANPEP) (Native Protein)
-
Alternative techniquesera
-
Tissueserum
-
Gene info
-
Identity
-
Gene
-
Long gene namealanyl aminopeptidase, membrane
-
Synonyms gene
-
Synonyms gene name
- alanyl (membrane) aminopeptidase
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1989-02-28
-
Entrez gene record
-
Pubmed identfication
-
Classification
- M1 metallopeptidases
- CD molecules
- Aminopeptidases
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data