Recombinant Rat Protein S100-A9(S100a9)

  • Catalog number
    RPC20382
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    P50116
  • Gene number
    S100a9
  • Other name
    Calgranulin-B; Migration inhibitory factor-related protein 14; Short name:MRP-14; Short name:p14; Myeloid-related protein 14; S100 calcium-binding protein A9
  • Protein origin
    E.coli
  • Protein region
    2-113aa
  • Protein sequence
    AAKTGSQLERSISTIINVFHQYSRKYGHPDTLNKAEFKEMVNKDLPNFLKREKRNENLLRDIMEDLDTNQDNQLSFEECMMLMGKLIFACHEKLHENNPRGHDHSHGKGCGK
  • Information about sequence
    Full Length
  • Expected molecular weight
    28.32kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    S100A9, PCDHGA9, SNAR-A9, S100A1, S100Z, S100A8
  • Short name
    Recombinant Protein S100-A9(S100a9)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Rat, Rats
  • Alternative name
    Rec. Rat Protein S100-A9(S100 calcium binding protein A9)
  • Alternative technique
    rec
  • Alternative to gene target
    S100 calcium binding protein A9, 60B8AG and CAGB and CFAG and CGLB and L1AG and LIAG and MAC387 and MIF and MRP14 and NIF and P14, S100A9 and IDBG-102644 and ENSG00000163220 and 6280, RAGE receptor binding, nuclei, GM5849 and IDBG-705944 and ENSMUSG00000096621 and 545541, S100A9 and IDBG-632885 and ENSBTAG00000006505 and 532569
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    small NF90 (ILF3) associated RNA A9
  • Synonyms gene name
    • small nuclear ILF3/NF90-associated RNA A9
    • small ILF3/NF90-associated RNA A9
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-06-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small NF90 (ILF3) associated RNAs
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee