Recombinant Rat Protein S100-A8(S100a8)

  • Catalog number
    RPC20079
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Rattus norvegicus (Rat)
  • Protein number
    P50115
  • Gene number
    S100a8
  • Other name
    Calgranulin-AMigration inhibitory factor-related protein 8 ; MRP-8 ; p8S100 calcium-binding protein A8
  • Protein origin
    E.coli
  • Protein region
    2-89aa
  • Protein sequence
    ATELEKALSNVIEVYHNYSGIKGNHHALYRDDFRKMVTTECPQFVQNKNTESLFKELDVNSDNAINFEEFLVLVIRVGVAAHKDSHKE
  • Information about sequence
    Full Length
  • Expected molecular weight
    14.2kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • About
    Rats are used to make rat monoclonal anti mouse antibodies. There are less rat- than mouse clones however. Rats genes from rodents of the genus Rattus norvegicus are often studied in vivo as a model of human genes in Sprague-Dawley or Wistar rats.
  • Latin name
    Rattus norvegicus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    S100A8, SNAR-A8, PCDHGA8, S100A1, S100Z, ZNF3, S100A9
  • Short name
    Recombinant Protein S100-A8(S100a8)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Rat
  • Label
    N-terminal 6xHis-tagged
  • Species
    Rat, Rats
  • Alternative name
    Rec. Rat Protein S100-A8(S100 calcium binding protein A8)
  • Alternative technique
    rec
  • Alternative to gene target
    S100 calcium binding protein A8, 60B8AG and CAGA and CFAG and CGLA and CP-10 and L1Ag and MA387 and MIF and MRP8 and NIF and P8, S100A8 and IDBG-102654 and ENSG00000143546 and 6279, RAGE receptor binding, nuclei, S100a8 and IDBG-168077 and ENSMUSG00000056054 and 20201, S100A8 and IDBG-632868 and ENSBTAG00000012640 and 616818
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    small NF90 (ILF3) associated RNA A8
  • Synonyms gene name
    • small nuclear ILF3/NF90-associated RNA A8
    • small ILF3/NF90-associated RNA A8
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-06-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small NF90 (ILF3) associated RNAs
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee