Recombinant Pseudomonas aeruginosa Protease lasA(lasA)

  • Catalog number
    RPC20467
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
  • Protein number
    P14789
  • Gene number
    lasA
  • Other name
    Staphylolytic protease
  • Protein origin
    E.coli
  • Protein region
    237-418aa
  • Protein sequence
    APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL
  • Information about sequence
    Full Length of Mature Protein
  • Expected molecular weight
    36.2kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • About
    Pseudomonas is a Gram-negative bacteria. Pseudomonas genomic sequences are used in medical research. A problem in hostpital is often the Pseudomonas Aeruginosa containing multi drug resistancy properties that are transmitted through plasmids. The MDR property is transmitter by the R plasmid.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Pseudomonas aeruginosa Protease lasA(lasA)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Pseudomonas, Pseudomonas
  • Alternative name
    Rec. Pseudomonas aeruginosa Protease lasA(lasA)
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee