Recombinant Pig Vascular endothelial growth factor A(VEGFA)

• Catalog number
  RPC20101
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Sus scrofa (Pig)
• Protein number
  P49151
• Gene number
  VEGFA
• Other name
  Vascular permeability factor ; VPF
• Protein origin
  E.coli
• Protein region
  27-190aa
• Protein sequence
  APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
• Information about sequence
  Full Length
• Expected molecular weight
  23.3kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• About
  Pigs and the smaller guinea pigs are frequent used as models for humans.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Vascular   endothelial   growth   factor   VEGFA  
• Gene symbol
  VEGFA
• Short name
  Recombinant Vascular endothelial growth factor A(VEGFA)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-tagged
• Species
  Pig, Pigs and Guinea pigs
• Alternative name
  Rec. swine Vascular endothelial growth factor A(vascular endothelial growth factor A)
• Alternative technique
  rec
• Alternative to gene target
  vascular endothelial growth factor A, MVCD1 and VEGF and VPF, VEGFA and IDBG-88716 and ENSG00000112715 and 7422, extracellular matrix binding, Extracellular, Vegfa and IDBG-185847 and ENSMUSG00000023951 and 22339, VEGFA and IDBG-631944 and ENSBTAG00000047561 and 101904706
• Tissue
  vascular

Gene info

• Identity
  HGNC:12680
• Gene
  VEGFA
• Long gene name
  vascular endothelial growth factor A
• Synonyms gene
  • VEGF
• Synonyms gene name
  • vascular endothelial growth factor
• Synonyms
  • VEGF-A
  • VPF
• GenBank acession
  • AB021221
• Locus
  6p21.1
• Discovery year
  1994-01-10
• Entrez gene record
  7422
• Pubmed identfication
  • 8786112
• RefSeq identity
  • NM_001025366
• Classification
  • VEGF family
• VEGA ID
  OTTHUMG00000014745
• Locus Specific Databases
  • ALSOD, the Amyotrophic Lateral Sclerosis Online Genetic Database

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products