Recombinant Mouse Serum amyloid A-1 protein(Saa1)

  • Catalog number
    RPC20304
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    P05366
  • Gene number
    Saa1
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    20-122aa
  • Protein sequence
    GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
  • Information about sequence
    Full Length
  • Expected molecular weight
    27.75kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants, Sera
  • Description
    Azide Free Serum for cell culture FBS fetal bovine serum. Filtered serum for sterility. The polyclonal serum contains no red or white blood cells or clotting factors; it is the blood plasma not including the fibrinogens. Serum includes all proteins and antibodies not used in blood clotting (coagulation) and all the electrolytes, antibodies, antigens, hormones, and any exogenous substances like drugs and microorganisms. Plasmas on request.
  • About
    Serum should be stored at +5°C
  • Gene target
    amyloid   A-1   protein   Saa1  
  • Gene symbol
    SFTPA1, IGHV5-10-1, RFC4, RFC2, NR1H3, SPI1, H2AC8, SNAR-A1, HLA-A, PCDHGA1
  • Short name
    Recombinant Mouse Serum amyloid A-1 protein(Saa1)
  • Technique
    Recombinant, Mouse, serum, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse blood serum amyloid A-1 protein(serum amyloid A1)
  • Alternative technique
    rec, sera, murine
  • Alternative to gene target
    serum amyloid A1, PIG4 and SAA and SAA2 and TP53I4, SAA1 and IDBG-34659 and ENSG00000173432 and 6288, heparin binding, Extracellular
  • Tissue
    serum
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable 5-10-1
  • Synonyms gene
  • Synonyms gene name
    • immunoglobulin heavy variable 5-A (provisional, gene/pseudogene)
    • immunoglobulin heavy variable 5-A (provisional)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-04
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    small NF90 (ILF3) associated RNA A1
  • Synonyms gene name
    • small nuclear ILF3/NF90-associated RNA A1
    • small ILF3/NF90-associated RNA A1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-06-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small NF90 (ILF3) associated RNAs
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee