Recombinant Mouse Protein S100-A8(S100a8)

  • Catalog number
    RPC20077
  • Price
    Please ask
  • Size
    500 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    P27005
  • Gene number
    S100a8
  • Other name
    Calgranulin-AChemotactic cytokine CP-10Leukocyte L1 complex light chain; Migration inhibitory factor-related protein 8 ; MRP-8 ; p8Pro-inflammatory S100 cytokine; S100 calcium-binding protein A8
  • Protein origin
    E.coli
  • Protein region
    2-89aa
  • Protein sequence
    PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE
  • Information about sequence
    Full Length
  • Expected molecular weight
    26.16kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    S100A8, SNAR-A8, PCDHGA8, S100A1, S100Z, ZNF3, S100A9
  • Short name
    Recombinant Mouse Protein S100-A8(S100a8)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse Protein S100-A8(S100 calcium binding protein A8)
  • Alternative technique
    rec, murine
  • Alternative to gene target
    S100 calcium binding protein A8, 60B8AG and CAGA and CFAG and CGLA and CP-10 and L1Ag and MA387 and MIF and MRP8 and NIF and P8, S100A8 and IDBG-102654 and ENSG00000143546 and 6279, RAGE receptor binding, nuclei, S100a8 and IDBG-168077 and ENSMUSG00000056054 and 20201, S100A8 and IDBG-632868 and ENSBTAG00000012640 and 616818
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    small NF90 (ILF3) associated RNA A8
  • Synonyms gene name
    • small nuclear ILF3/NF90-associated RNA A8
    • small ILF3/NF90-associated RNA A8
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2008-06-20
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Small NF90 (ILF3) associated RNAs
Gene info
Gene info
Gene info
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee