Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial

• Catalog number
  RPC20218
• Price
  Please ask
• Size
  200 μg

• Verified reactivity
  Mus musculus (Mouse)
• Protein number
  P27106
• Gene number
  Amh
• Other name
  Anti-Muellerian hormone ; AMH; Muellerian-inhibiting substance ; MIS
• Protein origin
  Yeast
• Protein region
  450-552aa
• Protein sequence
  DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
• Information about sequence
  Partial
• Expected molecular weight
  13kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Muellerian-inhibiting   factor   Amh   partial  
• Short name
  Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Label
  N-terminal 6xHis-tagged
• Species
  Mouse, Mouses
• Alternative name
  Rec. Mouse Muellerian-inhibiting factor(anti-Mullerian hormone) ,partial
• Alternative technique
  rec, murine
• Alternative to gene target
  anti-Mullerian hormone, MIF and MIS, AMH and IDBG-15818 and ENSG00000104899 and 100423031,268, growth factor activity, Extracellular, Amh and IDBG-176152 and ENSMUSG00000035262 and 11705, AMH and IDBG-644611 and ENSBTAG00000014955 and 280718

MeSH Data

• Name
  Radioimmunosorbent Test
• Concept
  Scope note: Radioimmunoassay of proteins using antibody coupled to an immunosorbent.
• Tree numbers
  • E05.478.566.380.830
  • E05.478.566.639.830
  • E05.601.470.380.830
  • E05.601.470.639.830
• Qualifiers
  ethics, mortality, psychology, trends, veterinary, history, classification, economics, instrumentation, methods, nursing, standards, adverse effects, statistics & numerical data

Product images

Similar products