Recombinant Mouse Heterogeneous nuclear ribonucleoproteins A2/B1(Hnrnpa2b1)

  • Catalog number
    RPC20582
  • Price
    Please ask
  • Size
    10 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    O88569 
  • Gene name
    Hnrnpa2b1
  • Other name
    hnRNP A2/B1
  • Protein origin
    E.coli
  • Protein region
    1-353aa
  • Protein sequence
    MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY
  • Information about sequence
    Full Length
  • Expected molecular weight
    59,18kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Mouse Heterogeneous ribonucleoproteins A2/B1(Hnrnpa2b1)
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse Heterogeneous nuclear ribonucleoproteins A2/B1(Hnrnpa2b1)
  • Alternative technique
    rec, murine
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee