Recombinant Mouse Granzyme A(Gzma)

• Catalog number
  RPC20502
• Price
  Please ask
• Size
  200 μg

• Verified reactivity
  Mus musculus (Mouse)
• Protein number
  P11032
• Gene number
  Gzma
• Other name
  Autocrine thymic lymphoma granzyme-like serine protease; CTLA-3; Fragmentin-1; T cell-specific serine protease 1
• Protein origin
  E.coli
• Protein region
  29-260aa
• Protein sequence
  IIGGDTVVPHSRPYMALLKLSSNTICAGALIEKNWVLTAAHCNVGKRSKFILGAHSINKEPEQQILTVKKAFPYPCYDEYTREGDLQLVRLKKKATVNRNVAILHLPKKGDDVKPGTRCRVAGWGRFGNKSAPSETLREVNITVIDRKICNDEKHYNFHPVIGLNMICAGDLRGGKDSCNGDSGSPLLCDGILRGITSFGGEKCGDRRWPGVYTFLSDKHLNWIKKIMKGSV
• Information about sequence
  Full Length
• Expected molecular weight
  42.63kD
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Granzyme   Gzma  
• Gene symbol
  GZMA
• Short name
  Recombinant Mouse Granzyme A(Gzma)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Label
  N-terminal 6xHis-B2M-tagged
• Species
  Mouse, Mouses
• Alternative name
  Rec. Mouse Granzyme A(granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3))
• Alternative technique
  rec, murine
• Alternative to gene target
  granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3), CTLA3 and HFSP, GZMA and IDBG-20850 and ENSG00000145649 and 3001, protein homodimerization activity, nuclei, Gzma and IDBG-183453 and ENSMUSG00000023132 and 14938, BT.58970 and IDBG-629315 and ENSBTAG00000021958 and 539093

Gene info

• Identity
  HGNC:4708
• Gene
  GZMA
• Long gene name
  granzyme A
• Synonyms gene
  • HFSP
  • CTLA3
• Synonyms gene name
  • granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3)
• Synonyms name
  • CTL tryptase
  • Cytotoxic T-lymphocyte-associated serine esterase-3
  • Hanukah factor serine protease)
  • granzyme 1
• Locus
  5q11.2
• Discovery year
  1988-05-31
• Entrez gene record
  3001
• Pubmed identfication
  • 3262682
  • 3533635
• RefSeq identity
  • NM_006144
• Classification
  • Granule associated serine proteases of immune defence
• VEGA ID
  OTTHUMG00000097011

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products