Recombinant Mouse Complement C1q subcomponent subunit A(C1qa),partial

  • Catalog number
    RPC20013
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    P98086
  • Gene number
    C1qa
  • Other name
    no alternative name
  • Protein origin
    E.coli
  • Protein region
    23-245aa
  • Protein sequence
    EDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIRTGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSGGQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA
  • Information about sequence
    Partial
  • Expected molecular weight
    39.5kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Mouse Complement C1q subcomponent subunit A(C1qa),partial
  • Technique
    Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse Complement C1q subcomponent functionnal sequence A(complement component 1, q subcomponent, A chain),partial
  • Alternative technique
    rec, murine
  • Alternative to gene target
    complement component 1, q subcomponent, A chain, C1QA and IDBG-93718 and ENSG00000173372 and 712, protein binding, Extracellular, C1qa and IDBG-198277 and ENSMUSG00000036887 and 12259, C1QA and IDBG-645509 and ENSBTAG00000007153 and 534961
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee