Recombinant Human MORC family CW-type zinc finger protein 3(MORC3),partial

  • Catalog number
    RPC20339
  • Price
    Please ask
  • Size
    100 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q14149
  • Gene number
    MORC3
  • Other name
    Nuclear matrix protein 21 ; Zinc finger CW-type coiled-coil domain protein 3
  • Protein origin
    E.coli
  • Protein region
    1-290aa
  • Protein sequence
    MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
  • Information about sequence
    Partial
  • Expected molecular weight
    48.69kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Finger like and finger proteins are like zinc fingers small proteins with a structural motif that is characterized by the coordination of one or more zinc ions in order to stabilize the fold. Homeobox and homeodomain families.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    MORC   family   zinc   finger   protein   MORC3   partial  
  • Gene symbol
    MORC1, MORC3
  • Short name
    Recombinant MORC family CW- zinc finger protein 3(MORC3),partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens MORC family CW-classification zinc finger protein 3(MORC3),partial
  • Alternative technique
    rec
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee