Recombinant Human Islet amyloid polypeptide protein(IAPP)

#
  • Catalog number
    RPC20200
  • Price:

    Please ask

    Ask for price
  • Size
    10 μg
# #
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P10082
  • Gene name
    IAPP
  • Other name
    PYY-I
  • Protein origin
    E.coli
  • Protein region
    34-70aa
  • Protein sequence
    EAPREDASPEELNRYYASLRHYLNLVTRQRYGKRDGP
  • Information about sequence
    Full Length
  • Expected molecular weight
    31,3kDa
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
  • Gene symbol
    IAPP
  • Short name
    Recombinant Islet amyloid polypeptide protein(IAPP)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal GST-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Islet amyloid multipeptide protein(islet amyloid polypeptide)
  • Alternative technique
    rec
  • Alternative to gene target
    islet amyloid polypeptide, DAP and IAP, IAPP and IDBG-22720 and ENSG00000121351 and 3375, identical protein binding, Extracellular, Iapp and IDBG-196723 and ENSMUSG00000041681 and 15874, IAPP and IDBG-638993 and ENSBTAG00000010530 and 100138011
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee