Recombinant Human Homeobox protein Nkx-3.2(Nkx3-2)

  • Catalog number
    RPC20420
  • Price
    Please ask
  • Size
    50 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P97503
  • Gene number
    Nkx3-2
  • Other name
    Bagpipe homeobox protein homolog 1; Homeobox protein NK-3 homolog B
  • Protein origin
    E.coli
  • Protein region
    1-333aa
  • Protein sequence
    MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCELHAAKDLEEEAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVPGLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ
  • Information about sequence
    Full Length
  • Expected molecular weight
    41.96kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Homeobox protein Nkx-3 2(Nkx3-2)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 10xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Homeobox protein Nkx-3.2(NK3 homeobox 2)
  • Alternative technique
    rec
  • Alternative to gene target
    NK3 homeobox 2, BAPX1 and NKX3.2 and NKX3B and SMMD, NKX3-2 and IDBG-10163 and ENSG00000109705 and 579, sequence-specific DNA binding, nuclei, Nkx3-2 and IDBG-160594 and ENSMUSG00000049691 and 12020, BT.106450 and IDBG-643956 and ENSBTAG00000010896 and 616907
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee