Recombinant Human Glutaminyl-peptide cyclotransferase(QPCT)

#

• Catalog number
  RPC20069
• Price:

  Please ask

  Ask for price
• Size
  50 μg

# #

• Verified reactivity
  Homo sapiens (Human)
• Protein number
  Q16769
• Gene number
  QPCT
• Other name
  Glutaminyl cyclase ; QC ; sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase ; EC
• Protein origin
  E.coli
• Protein region
  29-361aa
• Protein sequence
  VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
• Information about sequence
  Full Length
• Expected molecular weight
  53.9kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

#

• Gene target
  Glutaminyl-peptide   cyclotransferase   QPCT  
• Gene symbol
  QPCT
• Short name
  Recombinant Glutaminyl-peptide cyclotransferase(QPCT)
• Technique
  Recombinant, peptide, peptides, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Human, Humans
• Alternative name
  Rec. H. sapiens Glutaminyl-short protein sequence cyclotransferase(QPCT)
• Alternative technique
  rec, peptides

Gene info

• Identity
  HGNC:9753
• Gene
  QPCT
• Long gene name
  glutaminyl-peptide cyclotransferase
• Synonyms
  • QC
  • GCT
• Synonyms name
  • glutaminyl cyclase
• GenBank acession
  • X71125
• Locus
  2p22.2
• Discovery year
  1999-11-16
• Entrez gene record
  25797
• Pubmed identfication
  • 7999256
• Classification
  • M28 metallopeptidases
• VEGA ID
  OTTHUMG00000100963

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products