Recombinant Human Estrogen receptor beta(ESR2),partial

• Catalog number
  RPC20287
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Homo sapiens (Human)
• Protein number
  Q92731
• Gene number
  ESR2
• Other name
  Short name:; ER-beta; Alternative name(s):; Nuclear receptor subfamily 3 group A member 2
• Protein origin
  E.coli
• Protein region
  2-323AA
• Protein sequence
  DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGFVELS
• Information about sequence
  Partial
• Expected molecular weight
  51.79kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Estrogen   receptor   beta   ESR2   partial  
• Gene symbol
  ESR2
• Short name
  Recombinant Estrogen receptor beta(ESR2),partial
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-SUMO-tagged
• Species
  Human, Humans
• Alternative name
  Rec. H. sapiens Estrogen receptor b(estrogen receptor 2 (ER beta)),partial
• Alternative technique
  rec
• Alternative to gene target
  estrogen receptor 2 (ER beta), ER-BETA and Erb and ESR-BETA and ESRB and ESTRB and NR3A2, ESR2 and IDBG-9004 and ENSG00000140009 and 2100, receptor anta this GO nist activity, nuclei, Esr2 and IDBG-150083 and ENSMUSG00000021055 and 13983, ESR2 and IDBG-646767 and ENSBTAG00000004498 and 281146

Gene info

• Identity
  HGNC:3468
• Gene
  ESR2
• Long gene name
  estrogen receptor 2
• Synonyms gene name
  • estrogen receptor 2 (ER beta)
• Synonyms
  • NR3A2
  • Erb
  • ER-beta
• Synonyms name
  • ER beta
  • estrogen receptor beta
  • oestrogen receptor beta
  • nuclear receptor subfamily 3 group A member 2
• GenBank acession
  • X99101
• Locus
  14q23.2-q23.3
• Discovery year
  1997-01-17
• Entrez gene record
  2100
• Pubmed identfication
  • 8769313
• Classification
  • Estrogen receptors
• VEGA ID
  OTTHUMG00000141306

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products