Recombinant Human Desmoplakin(DSP) ,partial

  • Catalog number
    RPC20034
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P15924
  • Gene number
    DSP
  • Other name
    250/210 kDa paraneoplastic pemphigus antigen
  • Protein origin
    E.coli
  • Protein region
    78-300aa
  • Protein sequence
    CSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSD
  • Information about sequence
    Partial
  • Expected molecular weight
    42kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    DSP
  • Short name
    Recombinant Desmoplakin(DSP) ,partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Desmoplakin(desmoplakin) ,partial
  • Alternative technique
    rec
  • Alternative to gene target
    desmoplakin, DP and DPI and DPII, DSP and IDBG-59899 and ENSG00000096696 and 1832, protein binding, nuclei, Dsp and IDBG-145817 and ENSMUSG00000054889 and 109620, DSP and IDBG-636412 and ENSBTAG00000015106 and 514360
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee