Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8)

#
  • Catalog number
    RPC20523
  • Price:

    Please ask

    Ask for price
  • Size
    500 μg
# #
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P31997
  • Gene number
    CEACAM8
  • Other name
    CD67 antigen; Carcinoembryonic antigen CGM6; Non-specific cross-reacting antigen NCA-95; CD_antigen: CD66b
  • Protein origin
    E.coli
  • Protein region
    35-320aa
  • Protein sequence
    QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
  • Information about sequence
    Full Length of Mature Protein
  • Expected molecular weight
    47.75kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    cell adhesion molecules play a role in cell growth and activation and are often identified by WB or ELISA as in the Recombinant Carcinoembryonic antigen- adhesion molecule 8(CEACAM8). Antigens are peptides or recombinant or native dependent on the production method. For cells, cell lines and tissues in culture till half confluency. Whole adhesion and interacting molecules are  present in lysates used as reference for ELISA quantification of these molecules and their subunits.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
#
  • Gene target
  • Gene symbol
    CEACAM8
  • Short name
    Recombinant Carcinoembryonic antigen- adhesion molecule 8(CEACAM8)
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Carcinoembryonic protein-related cellular adhesion molecule 8(carcinoembryonic antigen-related cellular adhesion molecule 8)
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    carcinoembryonic antigen-related cell adhesion molecule 8, CD66b and CD67 and CGM6 and NCA-95, CEACAM8 and IDBG-54589 and ENSG00000124469 and 1088, protein binding, Extracellular
  • Tissue
    cell
Gene info
  • Identity
  • Gene
  • Long gene name
    CEA cell adhesion molecule 8
  • Synonyms gene
  • Synonyms gene name
    • carcinoembryonic antigen-related cell adhesion molecule 8
    • carcinoembryonic antigen related cell adhesion molecule 8
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1991-09-12
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • V-set domain containing
    • CEA cell adhesion molecule family
    • CD molecules
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee