Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7(CEACAM7)

  • Catalog number
    RPC20387
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    Q14002
  • Gene number
    CEACAM7
  • Other name
    Carcinoembryonic antigen CGM2
  • Protein origin
    E.coli
  • Protein region
    36-242aa
  • Protein sequence
    TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
  • Information about sequence
    Full Length
  • Expected molecular weight
    39.34kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    cell adhesion molecules play a role in cell growth and activation and are often identified by WB or ELISA as in the Recombinant Carcinoembryonic antigen- adhesion molecule 7(CEACAM7). Antigens are peptides or recombinant or native dependent on the production method. For cells, cell lines and tissues in culture till half confluency. Whole adhesion and interacting molecules are  present in lysates used as reference for ELISA quantification of these molecules and their subunits.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    CEACAM7
  • Short name
    Recombinant Carcinoembryonic antigen- adhesion molecule 7(CEACAM7)
  • Technique
    Recombinant, antigen, antigenes, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Carcinoembryonic protein-related cellular adhesion molecule 7(carcinoembryonic antigen-related cellular adhesion molecule 7)
  • Alternative technique
    rec, antigenes
  • Alternative to gene target
    carcinoembryonic antigen-related cell adhesion molecule 7, CEA and CGM2, CEACAM7 and IDBG-53139 and ENSG00000007306 and 1087, protein binding, Plasma membranes
  • Tissue
    cell
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Experimentation on, or using the organs or tissues from, a human or other mammalian conceptus during the prenatal stage of development that is characterized by rapid morphological changes and the differentiation of basic structures. In humans, this includes the period from the time of fertilization to the end of the eighth week after fertilization.
  • Tree numbers
    • E05.313
  • Qualifiers
    economics, ethics, history, legislation & jurisprudence
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee