Recombinant Human Bone sialoprotein 2 (IBSP),Partial

  • Catalog number
    RPC20495
  • Price
    Please ask
  • Size
    10 μg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P21815
  • Gene name
    IBSP
  • Other name
    Bone sialoprotein II
  • Protein origin
    E.coli
  • Protein region
    129-281aa
  • Protein sequence
    AIQLPKKAGDITNKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGANAEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYESE
  • Information about sequence
    Partial
  • Expected molecular weight
    32,98kD
  • Protein purity
    ≥ 90%
  • Verified applications
    See product datasheet or contact us
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    IBSP
  • Short name
    Recombinant Bone sialoprotein 2 (IBSP),Partial
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens Bone sialoprotein 2 (integrin-binding sialoprotein),Partial
  • Alternative technique
    rec
  • Alternative to gene target
    integrin-binding sialoprotein, BNSP and BSP and BSP-II and SP-II, IBSP and IDBG-29240 and ENSG00000029559 and 3381, molecular_function, Extracellular, Ibsp and IDBG-185413 and ENSMUSG00000029306 and 15891, IBSP and IDBG-641213 and ENSBTAG00000000470 and 281233
  • Tissue
    bone
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee