Recombinant Human Alpha-synuclein protein(SNCA)

  • Catalog number
    RPC20244
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Homo sapiens (Human)
  • Protein number
    P37840
  • Gene number
    SNCA
  • Other name
    Non-A beta component of AD amyloidNon-A4 component of amyloid precursor ; NACP
  • Protein origin
    Yeast
  • Protein region
    1-140aa
  • Protein sequence
    MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
  • Information about sequence
    Full Length
  • Expected molecular weight
    16.5kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    The Recombinant Alpha-synuclein protein(SNCA) is a α- or alpha protein sometimes glycoprotein present in blood.
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    SNCA-AS1, SNCA
  • Short name
    Recombinant Alpha-synuclein protein(SNCA)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Species
    Human, Humans
  • Alternative name
    Rec. H. sapiens a-synuclein protein(synuclein, alpha (non A4 component on amyloid precursor))
  • Alternative technique
    rec
  • Alternative to gene target
    synuclein, alpha (non A4 component of amyloid precursor), NACP and PARK1 and PARK4 and PD1, SNCA and IDBG-30077 and ENSG00000145335 and 6622, phosphoprotein binding, nuclei, Snca and IDBG-152558 and ENSMUSG00000025889 and 20617, SNCA and IDBG-641103 and ENSBTAG00000024957 and 282857
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee