Recombinant Horse Major allergen Equ c 1

  • Catalog number
    RPC20421
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Equus caballus (Horse)
  • Protein number
    Q95182
  • Gene number
    Please refer to GenBank
  • Other name
    Allergen: Equ c 1
  • Protein origin
    Yeast
  • Protein region
    16-187aa
  • Protein sequence
    QQEENSDVAIRNFDISKISGEWYSIFLASDVKEKIEENGSMRVFVDVIRALDNSSLYAEYQTKVNGECTEFPMVFDKTEEDGVYSLNYDGYNVFRISEFENDEHIILYLVNFDKDRPFQLFEFYAREPDVSPEIKEEFVKIVQKRGIVKENIIDLTKIDRCFQLRGNGVAQA
  • Information about sequence
    Full Length of Mature Protein
  • Expected molecular weight
    22.1kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Horse (Equus ferus caballus) sera and plasma contain equine IgGs, Immunoglobulins. ELISA test are used to determine quantitatively the presence in horse serum of the antigen by a polyclonal antibody to the equine epitope selected for the ELISA kit. A blocking solution for the native horse or equine immunoglobulins in available in the ELISA protocol.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Major   allergen   Equ  
  • Short name
    Recombinant Major allergen Equ c 1
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    Horse
  • Label
    N-terminal 6xHis-tagged
  • Species
    Horse, Horses
  • Alternative name
    Rec. Horse Major allergen Equ c 1
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee