Recombinant Glycine max Stress-induced protein SAM22(SAM22)

  • Catalog number
    RPC20254
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Glycine max (Soybean) (Glycine hispida)
  • Protein number
    P26987
  • Gene number
    SAM22
  • Other name
    no alternative name
  • Protein origin
    Yeast
  • Protein region
    1-158as
  • Protein sequence
    MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLEDGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKYETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
  • Information about sequence
    Full Length
  • Expected molecular weight
    18.8kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Induced protein genes, factors or kinases, increase the production of (an enzyme or other protein) at the level of genetic transcription.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Glycine   max   Stress   protein   SAM22   SAM22  
  • Short name
    Recombinant Glycine max Stress- protein SAM22(SAM22)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-tagged
  • Alternative name
    Rec. Glycine v-myc myelocytomatosis viral oncogene homolog (avian) associated factor X Stress-induced protein SAM22(SAM22)
  • Alternative technique
    rec
  • Alternative to gene target
    MYC associated factor X, bHLHd4, MAX and IDBG-9524 and ENSG00000125952 and 4149, protein dimerization activity, nuclei, Max and IDBG-151490 and ENSMUSG00000059436 and 17187, MAX and IDBG-646780 and ENSBTAG00000017994 and 540616
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee