Recombinant Escherichia coli Outer membrane protein C(ompC)

• Catalog number
  RPC20129
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Escherichia coli (strain K12)
• Protein number
  P06996
• Gene number
  ompC
• Other name
  Outer membrane protein 1BPorin OmpC
• Protein origin
  E.coli
• Protein region
  22-367aa
• Protein sequence
  AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
• Information about sequence
  Full Length
• Expected molecular weight
  54.28kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Description
  Associated membrane protein types are lipopolysaccharide selective barriers. Biological membranes include cell membranes, outer coverings of cells or organelles that allow passage of certain proteins and nuclear membranes, which cover a cell nucleus; and tissue membranes, such as mucosae and serosae. 
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Escherichia   coli   Outer   membrane   protein   ompC  
• Short name
  Recombinant Escherichia coli Outer protein C(ompC)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  Escherichia coli
• Label
  N-terminal 6xHis-SUMO-tagged
• Alternative name
  Rec. Escherichia coli Outer membrane protein C(ompC)
• Alternative technique
  rec, escherichia

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products