Recombinant Dog Minor allergen Can f 2

  • Catalog number
    RPC20281
  • Price
    Please ask
  • Size
    1 mg
  • Verified reactivity
    Canis lupus familiaris (Dog) (Canis familiaris)
  • Protein number
    O18874
  • Gene number
    Please refer to GenBank
  • Other name
    Allergen Dog 2; Allergen: Can f 2
  • Protein origin
    E.coli
  • Protein region
    19-180aa
  • Protein sequence
    QEGNHEEPQGGLEELSGRWHSVALASNKSDLIKPWGHFRVFIHSMSAKDGNLHGDILIPQDGQCEKVSLTAFKTATSNKFDLEYWGHNDLYLAEVDPKSYLILYMINQYNDDTSLVAHLMVRDLSRQQDFLPAFESVCEDIGLHKDQIVVLSDDDRCQGSRD
  • Information about sequence
    Full Length
  • Expected molecular weight
    34.37kDa
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Properties
    Canine or Canis Lupus is mostly Beagle used for drug research. bioma produces ELISA test kits and polyclonal antibodies.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
    Minor   allergen   Can  
  • Short name
    Recombinant Minor allergen Can f 2
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Label
    N-terminal 6xHis-SUMO-tagged
  • Species
    Dog, Dogs
  • Alternative name
    Rec. canine Minor allergen Can f 2
  • Alternative technique
    rec
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee