TGFBR2 Antibody / TGF beta Receptor II
-
Catalog numberR32086
-
PricePlease ask
-
Size0.1mg
-
-
CategoryAntibody
-
Concentration0.5mg/ml if reconstituted with 0.2ml sterile DI water
-
FormAntigen affinity purified
-
ConjugationUnconjugated
-
ClonePolyclonal antibody
-
Recognised antigenTGFBR2 / TGF beta Receptor II
-
Host animalRabbit (Oryctolagus cuniculus)
-
ClonalityPolyclonal (rabbit origin)
-
Species reactivityHuman (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
-
Tested applicationsWB
-
Recommended dilutionsWestern blot: 0.1-0.5ug/ml
-
NotesOptimal dilution of the TGF beta Receptor II antibody should be determined by the researcher.
-
Intented useThis TGF beta Receptor II antibodyis to be used only for research purposes and not for diagnostics..
-
UniprotP37173
-
PurityAntigen affinity
-
DescriptionTGFBR2 (Transforming growth factor, beta receptor II) is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
-
ImmunogenAmino acids TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK of human TGFBR2 were used as the immunogen for the TGF beta Receptor II antibody.
-
StorageAfter reconstitution, the TGF beta Receptor II antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
-
PropertiesIf you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Additional descriptionThe receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translationanticorps
-
Gene target
-
Gene symbolTGFBR2
-
Short nameAnti-TGFBR2 / TGF beta Receptor II
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
IsotypeRabbit IgG
-
Alternative nameAntibodies to TGFBR2 / TGF beta Receptor II
-
Alternative techniqueantibodies
-
Alternative to gene targettransforming growth factor, beta receptor II (70/80kDa), AAT3 and FAA3 and LDS1B and LDS2 and LDS2B and MFS2 and RIIC and TAAD2 and TGFbeta-RII and TGFR-2, TGFBR2 and IDBG-23359 and ENSG00000163513 and 7048, transforming growth factor beta receptor activity, Cell surfaces, Tgfbr2 and IDBG-203902 and ENSMUSG00000032440 and 21813, BT.66001 and IDBG-644071 and ENSBTAG00000019832 and 535376
-
Gene info
-
Identity
-
Gene
-
Long gene nametransforming growth factor beta receptor 2
-
Synonyms gene
-
Synonyms gene name
- transforming growth factor, beta receptor II (70/80kDa)
- transforming growth factor beta receptor II
-
Synonyms
-
Locus
-
Discovery year1993-09-30
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Type 2 receptor serine/threonine kinases
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data