TGFBR2 Antibody / TGF beta Receptor II

  • Catalog number
    R32086
  • Price
    Please ask
  • Size
    0.1mg
  • Category
    Antibody
  • Concentration
    0.5mg/ml if reconstituted with 0.2ml sterile DI water
  • Form
    Antigen affinity purified
  • Conjugation
    Unconjugated
  • Clone
    Polyclonal antibody
  • Recognised antigen
    TGFBR2 / TGF beta Receptor II
  • Host animal
    Rabbit (Oryctolagus cuniculus)
  • Clonality
    Polyclonal (rabbit origin)
  • Species reactivity
    Human (Homo sapiens) ; Due to limited knowledge and inability to test the antibody against all known species, we cannot guarantee that no other cross reactivity can occur.
  • Tested applications
    WB
  • Recommended dilutions
    Western blot: 0.1-0.5ug/ml
  • Notes
    Optimal dilution of the TGF beta Receptor II antibody should be determined by the researcher.
  • Intented use
    This TGF beta Receptor II antibodyis to be used only for research purposes and not for diagnostics..
  • Uniprot
    P37173
  • Purity
    Antigen affinity
  • Description
    TGFBR2 (Transforming growth factor, beta receptor II) is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
  • Immunogen
    Amino acids TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK of human TGFBR2 were used as the immunogen for the TGF beta Receptor II antibody.
  • Storage
    After reconstitution, the TGF beta Receptor II antibody may be kept for up to one month refrigerated at +4 degrees C.For long-term, aliquot and store at -20 deg. Celcius or lower. Cycles of freezing and thawing can denaturate the peptide chains of the antibodies and reduce their sensitivity and/or change their affinity. Prepare aliqotes in such a manner so that freeze-thaw cycles are minimized. Avoid repeated freezing and thawing.
  • Properties
    If you buy Antibodies supplied by NJS poly they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • Additional description
    The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • French translation
    anticorps
  • Gene target
    TGFBR2   TGF   beta   Receptor  
  • Gene symbol
    TGFBR2
  • Short name
    Anti-TGFBR2 / TGF beta Receptor II
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Isotype
    Rabbit IgG
  • Alternative name
    Antibodies to TGFBR2 / TGF beta Receptor II
  • Alternative technique
    antibodies
  • Alternative to gene target
    transforming growth factor, beta receptor II (70/80kDa), AAT3 and FAA3 and LDS1B and LDS2 and LDS2B and MFS2 and RIIC and TAAD2 and TGFbeta-RII and TGFR-2, TGFBR2 and IDBG-23359 and ENSG00000163513 and 7048, transforming growth factor beta receptor activity, Cell surfaces, Tgfbr2 and IDBG-203902 and ENSMUSG00000032440 and 21813, BT.66001 and IDBG-644071 and ENSBTAG00000019832 and 535376
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee