Recombinant Human Osteonectin/SPARC/BM-40 (C-6His)

  • Catalog number
    C388-50
  • Price
    Please ask
  • Size
    50 ug
  • Description
    Recombinant Human Osteonectin is produced by our Mammalian expression system and the target gene encoding Ala18-Ile303 is expressed with a 6His tag at the C-terminus.
  • Species reactivity
    Human
  • Origin
    Human cells
  • Peptide sequence
    APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVIVDHHHHHH
  • Estimated molecular weight
    33,73 kDa
  • Protein purity
    Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin level
    Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Shipping condition
    Ambient/Room Temperature
  • Package form
    Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Storage conditions
    Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
  • Reconstitution conditions
    See included datasheet or contact us for more information.
  • UniProt number
    P09486
  • Properties
    Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Gene symbol
    SPARC, SNORD115-40, CLMAT3, IGHV7-40, IGKV2D-40, IGKV2-40, IGLV1-40, PPID, IGHVII-40-1, PHF21A
  • Short name
    Recombinant Osteonectin/SPARC/BM-40 (C-6His)
  • Technique
    Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Species
    Human, Humans
  • Alternative name
    Human SPARC/Osteonectin/BM-40(C-6His)
  • Alternative technique
    rec
  • Alternative to gene target
    secreted protein, acidic, cysteine-rich (osteonectin), ON, SPARC and IDBG-54562 and ENSG00000113140 and 6678, extracellular matrix binding, nuclei, Sparc and IDBG-175174 and ENSMUSG00000018593 and 20692, SPARC and IDBG-646341 and ENSBTAG00000014835 and 282077
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable 7-40 (pseudogene)
  • Synonyms gene name
    • immunoglobulin heavy variable 7-40
    • immunoglobulin heavy variable 7-40 pseudogene
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-04
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
Gene info
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    peptidylprolyl isomerase D
  • Synonyms gene name
    • peptidylprolyl isomerase D (cyclophilin D)
  • Synonyms
  • Synonyms name
  • Locus
  • Discovery year
    1995-08-23
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Cyclophilin peptidylprolyl isomerases
    • Tetratricopeptide repeat domain containing
  • VEGA ID
Gene info
  • Identity
  • Gene
  • Long gene name
    immunoglobulin heavy variable (II)-40-1 (pseudogene)
  • Synonyms gene name
    • immunoglobulin heavy variable (II)-40-1
    • immunoglobulin heavy variable (II)-40-1 pseudogene
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    2000-04-17
  • Entrez gene record
  • RefSeq identity
  • Classification
    • Immunoglobulin heavy locus at 14q32.33
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee