Recombinant Human Mothers Against Decapentaplegic Homolog 3/SMAD3 (N-6His-Flag)

• Catalog number
  CE17-10
• Price
  Please ask
• Size
  10 ug

• Description
  Recombinant Human Mothers Against Decapentaplegic Homolog 3 is produced by our E.coli expression system and the target gene encoding Ser2-Ser425 is expressed with a 6His, Flag tag at the N-terminus.
• Species reactivity
  Human
• Origin
  Escherichia coli
• Peptide sequence
  MRGSHHHHHHGSDYKDDDDKSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
• Estimated molecular weight
  50,3 kDa
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of 20mM PB,500mM NaCl, pH7.5.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  P84022
• Other related products
• Properties
  An anti-flag tag (FLAG fusion protein) is use to detect a FLAG-tag, or FLAG octapeptide, or FLAG epitope that is a polypeptide protein tag that can be added to a protein using recombinant DNA. This FLAG-tags have the sequence DYKDDDDK motiv.  These tags are very useful to do protein purification by affinity chromatography. Also separation of recombinant, overexpressed proteins from cell lysates is done by FLAG go HIS tags. FLAGS are also used in the isolation of protein complexes with multiple subunits, because its mild purification procedure tends not to disrupt such complexes. It has been used to enrich proteins of height purity and quality to see the 3D crystal structure with x-ray. Suitable for in vivo use in cells. For electrophorese protein detection rabbit polyclonals anti Flag conjugation are the most suited antibodies. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Conjugation
  Flag
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Mothers   Against   Decapentaplegic   Homolog   3/SMAD3   N-6His  
• Gene symbol
  SMAD3
• Short name
  Recombinant Mothers Against Decapentaplegic Homolog 3/SMAD3 (N-6His- )
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  Flag
• Species
  Human, Humans
• Alternative name
  Recombinant Human SMAD3 (N-6His-Flag)
• Alternative technique
  rec
• Alternative to gene target
  SMAD family member 3, HSPC193 and HsT17436 and JV15-2 and LDS1C and LDS3 and MADH3, SMAD3 and IDBG-18366 and ENSG00000166949 and 4088, transforming growth factor beta receptor, nuclei, Smad3 and IDBG-175693 and ENSMUSG00000032402 and 17127, SMAD3 and IDBG-645466 and ENSBTAG00000012599 and 515125

Gene info

• Identity
  HGNC:6769
• Gene
  SMAD3
• Long gene name
  SMAD family member 3
• Synonyms gene
  • MADH3
• Synonyms gene name
  • MAD, mothers against decapentaplegic homolog 3 (Drosophila)
  • SMAD, mothers against DPP homolog 3 (Drosophila)
• Synonyms
  • JV15-2
  • HsT17436
• GenBank acession
  • BC050743
• Locus
  15q22.33
• Discovery year
  1996-11-15
• Entrez gene record
  4088
• Pubmed identfication
  • 8774881
  • 8673135
• RefSeq identity
  • NM_005902
• Classification
  • SMAD family
• VEGA ID
  OTTHUMG00000133230
• Locus Specific Databases
  • The Globin Gene Server

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products