Anti-TGFBR2/Tgf Beta Receptor Ii Picoband Antibody

  • Catalog number
    PB9829
  • Price
    Please ask
  • Size
    100µg/vial
  • Clonality
    Polyclonal
  • Sample Size Available
    30ug for $99, contact us for details
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human TGFBR2 (96-128aa TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
  • Form
    Lyophilized
  • Purification
    Immunogen affinity purified.
  • Storage Transport Conditions
    At -20°C for one year. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid repeated freezing and thawing.
  • Cross reactivity
    No cross reactivity with other proteins
  • Ig Type
    N/A
  • Reconstitution
    Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
  • Application Details
    Western blot, 0.1-0.5µg/ml, Human
  • Applications
    WB
  • Reactivity
    Human
  • Product Datasheet
    www.bosterbio.com/datasheet.php?sku=PB9829
  • Description
    This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided. Antibody for research use. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    TGFBR2
  • Short name
    Anti-TGFBR2/Tgf Beta Receptor Ii Picoband Antibody
  • Technique
    Antibody, anti-, anti, antibody to, antibodies, antibodies against human proteins, antibodies for
  • Host
    Rabbit
  • Isotype
    N/A
  • Alternative name
    Antibody totransforming growth factor, b receptor II (70/80kDa)/Tgf b Receptor Ii Picoband (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    transforming growth factor, beta receptor II (70/80kDa), AAT3 and FAA3 and LDS1B and LDS2 and LDS2B and MFS2 and RIIC and TAAD2 and TGFbeta-RII and TGFR-2, TGFBR2 and IDBG-23359 and ENSG00000163513 and 7048, transforming growth factor beta receptor activity, Cell surfaces, Tgfbr2 and IDBG-203902 and ENSMUSG00000032440 and 21813, BT.66001 and IDBG-644071 and ENSBTAG00000019832 and 535376
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee