Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Rabbit Caldesmon antibody

Rabbit Caldesmon antibody is available 6 times from Fitzgerald labs

70R-3420 | Rabbit Caldesmon 1 antibody size: 50 ug | 547.52 USD

Loading

70R-3868 | Rabbit Caldesmon 1 antibody size: 50 ug | 547.52 USD

Catalog number 70R-3868
Supplier fitzgerald
Price 547.52 USD
Size 50 ug
Applications WB
Research Area Cell Biology
Immunogen Caldesmon 1 antibody was raised using the middle region of CALD1 corresponding to a region with amino acids FSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGD
Specificity Caldesmon 1 antibody was raised against the middle region of CALD1
Cross Reactivity Human
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CALD1 antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Gene targetCaldesmon
Short name Rabbit Caldesmon 1 antibody
Isotype NA
Alternative name Rabbit polyclonal Caldesmon 1 antibody raised against the middle region of CALD1
1. Gene info
Identity 1441
Gene CALD1
Long gene name caldesmon 1
Synonyms
  • CDM
  • H-CAD
  • L-CAD
GenBank acession
  • M64110
Locus 7q33
Discovery year 1992-07-20
Entrez gene record 800
Pubmed identfication
  • 1885618
RefSeq identity
  • NM_033138
Havana BLAST/BLAT OTTHUMG00000155407
MeSH Data
Name Blotting, Western
Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200

70R-34478 | Rabbit Caldesmon antibody size: 100 ug | 470.09 USD

Loading

70R-31346 | Rabbit Caldesmon antibody size: 100 ug | 470.09 USD

Loading

70R-34477 | Rabbit Caldesmon antibody (Ser759) size: 100 ug | 470.09 USD

Loading

70R-31345 | Rabbit Caldesmon antibody (Ser789) size: 100 ug | 470.09 USD

Loading
Product Type Primary Antibodies
Shipping Info Blue Ice
Concentration 1 mg/ml
Product Subtype Purified Polyclonal Antibodies
Clone NA
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
About Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
Latin name Oryctolagus cuniculus
French translation anticorps
Technique Antibody, Rabbit
Host Rabbit
Alternative technique antibodies
Similar products
Rabbit AGBL4 antibody Suppplier: fitzgerald
Price: 602.82 USD
Rabbit DCUN1D5 antibody Suppplier: fitzgerald
Price: 580.70 USD
Rabbit DAB2 antibody Suppplier: fitzgerald
Price: 580.70 USD
Rabbit MTOR antibody Suppplier: fitzgerald
Price: 580.70 USD
Rabbit Aak1 antibody Suppplier: fitzgerald
Price: 547.52 USD
Rabbit NDP antibody Suppplier: fitzgerald
Price: 547.52 USD
Rabbit FLJ37543 antibody Suppplier: fitzgerald
Price: 547.52 USD
Rabbit STAT5a antibody Suppplier: fitzgerald
Price: 492.21 USD
Rabbit DHEA 15 antibody Suppplier: fitzgerald
Price: 488.90 USD
Rabbit ZNF592 antibody Suppplier: fitzgerald
Price: 470.09 USD
Rabbit MEKKK1 antibody Suppplier: fitzgerald
Price: 470.09 USD
Rabbit MRGX4 antibody Suppplier: fitzgerald
Price: 470.09 USD
Rabbit OR51F2 antibody Suppplier: fitzgerald
Price: 470.09 USD
TP53 Rabbit Polyclonal Antibody Suppplier: aviva
Price: 403.73 USD
Rabbit Anti Annexin A3 ANXA3 Polyclonal antibody Suppplier: Cloud Clone Corp
Price: 1 714.46 USD
Rabbit Anti Caldesmon CALD Polyclonal antibody Suppplier: Cloud Clone Corp
Price: 1 634.82 USD
Ask
Ajax processing
Close
Rabbit Caldesmon 1 antibody cat.: 70R-3868 - Gentaur.com
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Caldesmon
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee