Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human B7

Recombinant Human B7 is available 24 times from Novo labs

CR01-50 | Recombinant Human B7 Homolog 4/B7-H4/VTCN1 size: 50 ug | 359.02 USD

Loading

CR01-10 | Recombinant Human B7 Homolog 4/B7-H4/VTCN1 size: 10 ug | 173.61 USD

Loading

CR01-500 | Recombinant Human B7 Homolog 4/B7-H4/VTCN1 size: 500 ug | 1,906.13 USD

Loading

CR01-1000 | Recombinant Human B7 Homolog 4/B7-H4/VTCN1 size: 1 mg | 2,696.22 USD

Loading

CS41-10 | Recombinant Human B7 Homolog 6/B7-H6/NCR3LG1(C-6His) size: 10 ug | 173.61 USD

Loading

CS41-1000 | Recombinant Human B7 Homolog 6/B7-H6/NCR3LG1(C-6His) size: 1 mg | 2,696.22 USD

Catalog number CS41-1000
Supplier novo
Price 2,696.22 USD
Size 1 mg
Description Recombinant Human B7 Homolog 6 is produced by our Mammalian expression system and the target gene encoding Asp25-Ser262 is expressed with a 6His tag at the C-terminus.
Origin Human cells
Peptide sequence DLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSLTFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVVASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVTSCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSHHHHHH
Estimated molecular weight 27,5 kDa
Package form Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
Reconstitution conditions Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
UniProt number Q68D85
Gene targetHomolog 6/B7-H6/NCR3LG1(C-6His
Short name Recombinant B7 Homolog 6/B7-H6/NCR3LG1(C-6His)
Alternative name Recombinant Human B7-H6 (C-6His)
1. Gene info
Identity 42400
Gene NCR3LG1
Long gene name natural killer cell cytotoxicity receptor 3 ligand 1
Synonyms
  • DKFZp686O24166
  • B7-H6
Synonyms name
  • B7 homolog 6
Locus 11p15.1
Discovery year 2012-04-12
Entrez gene record 374383
Pubmed identfication
  • 19528259
RefSeq identity
  • NM_001202439
Classification
  • C1-set domain containing
  • B7 family
  • Receptor ligands
Havana BLAST/BLAT OTTHUMG00000165913
Product images
    #Human#.jpg

CS41-50 | Recombinant Human B7 Homolog 6/B7-H6/NCR3LG1(C-6His) size: 50 ug | 359.02 USD

Loading

CS41-500 | Recombinant Human B7 Homolog 6/B7-H6/NCR3LG1(C-6His) size: 500 ug | 1,906.13 USD

Loading

CK61-500 | Recombinant Human B7-1/CD80 (C-6His) size: 500 ug | 778.28 USD

Loading

CK61-50 | Recombinant Human B7-1/CD80 (C-6His) size: 50 ug | 167.70 USD

Loading

CK61-1000 | Recombinant Human B7-1/CD80 (C-6His) size: 1 mg | 1,198.72 USD

Loading

CK61-10 | Recombinant Human B7-1/CD80 (C-6His) size: 10 ug | 95.66 USD

Loading

C404-10 | Recombinant Human B7-2/CD86 (C-6His) size: 10 ug | 119.28 USD

Loading

C404-50 | Recombinant Human B7-2/CD86 (C-6His) size: 50 ug | 239.74 USD

Loading

C404-500 | Recombinant Human B7-2/CD86 (C-6His) size: 500 ug | 1,401.85 USD

Loading

C404-1000 | Recombinant Human B7-2/CD86 (C-6His) size: 1 mg | 1,976.99 USD

Loading

C475-1000 | Recombinant Human B7-H2/ICOSLG/CD275 (C-6His) size: 1 mg | 2,696.22 USD

Loading

C475-10 | Recombinant Human B7-H2/ICOSLG/CD275 (C-6His) size: 10 ug | 185.42 USD

Loading

C475-50 | Recombinant Human B7-H2/ICOSLG/CD275 (C-6His) size: 50 ug | 436.97 USD

Loading

C475-500 | Recombinant Human B7-H2/ICOSLG/CD275 (C-6His) size: 500 ug | 1,906.13 USD

Loading

CK62-500 | Recombinant Human B7-H3/CD276 (C-6His) size: 500 ug | 778.28 USD

Loading

CK62-1000 | Recombinant Human B7-H3/CD276 (C-6His) size: 1 mg | 1,198.72 USD

Loading

CK62-50 | Recombinant Human B7-H3/CD276 (C-6His) size: 50 ug | 167.70 USD

Loading

CK62-10 | Recombinant Human B7-H3/CD276 (C-6His) size: 10 ug | 95.66 USD

Loading
Species reactivity Human
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Technique Recombinant
Species Human
Alternative technique rec
Similar products
Recombinant Human IL-19 Suppplier: kingfisherbiotech
Price: 354.30 USD
Recombinant Human IL-18 Suppplier: kingfisherbiotech
Price: 354.30 USD
Recombinant Human IL-4 Suppplier: kingfisherbiotech
Price: 354.30 USD
Recombinant Human IL-13 Suppplier: kingfisherbiotech
Price: 354.30 USD
Recombinant Human IL-15 Suppplier: Amoytop Biotech
Price: 289.35 USD
Recombinant Human IL-19 Suppplier: Immunochemistry kits
Price: 259.82 USD
Recombinant Human IL-6 Suppplier: Immunochemistry kits
Price: 259.82 USD
Recombinant Human IL-8 Suppplier: Immunochemistry kits
Price: 259.82 USD
Recombinant Human IL-2 Suppplier: Amoytop Biotech
Price: 183.06 USD
Recombinant Human Il Suppplier: 101 Biosystem
Price: 179.51 USD
Recombinant Human IL-16 Suppplier: MyBioSource
Price: 5.91 USD
Recombinant Human TL-1A Suppplier: genways bulk
Price: 0.00 USD
Recombinant Human IL-2 Suppplier: genways bulk
Price: 0.00 USD
Recombinant Human IL-23 Suppplier: genways bulk
Price: 0.00 USD
Recombinant Human IL-34 Suppplier: genways bulk
Price: 0.00 USD
Recombinant Human IL-5 Suppplier: genways bulk
Price: 0.00 USD
Recombinant Human IL-10 Suppplier: genways bulk
Price: 0.00 USD
Recombinant Human IL-20 Suppplier: genways bulk
Price: 0.00 USD
Ask
Ajax processing
Close
Recombinant B7 Homolog 6/B7-H6/NCR3LG1(C-6His) | Technique a
Filters
EU:+32-(0)1-658-90-45 US:+1-(408)780-0908 [email protected]
  • Homolog
  • 4/B7-H4/VTCN1
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee