Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse)

  • Catalog number
    MAA537Hu22-100ul
  • Price
    Please ask
  • Size
    100ul
  • Description
    A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE)
  • Specifications
    Host: Mouse; Species Reactivity: Human, Mouse; Clonality: monoclonal; Tested applications: WB, IHC; Concentration: 1mg/mL; Isotype: IgG2b Kappa; Conjugation: Unconjugated
  • Additional_information
    Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT; Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
  • Storage_and_shipping
    Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
  • Notes
    Research Use Only.
  • Properties
    If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
  • About
    Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • French translation
    anticorps
  • Gene target
  • Short name
    Enolase, Neuron Specific (NSE) Monoclonal Antibody ( , Mouse)
  • Technique
    Antibody, Mouse, antibodies against human proteins, antibodies for, Monoclonals or monoclonal antibodies, mouses
  • Host
    mouse
  • Species
    Mouse, Humans, Mouses
  • Alternative name
    Enolase, Neuron Specific (NSE) monoclonal (antibody to-) (H. sapiens, Mouse)
  • Alternative technique
    antibodies, murine
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee