Recombinant Human Heat Shock Factor Protein 2/HSF2 (N-6His)
-
Catalog number
C284-500
-
Price
Please ask
-
Size
500 ug
-
-
Description
Recombinant Human Heat Shock Factor Protein-2 is produced by our E.coli expression system and the target gene encoding Ser411-Ser536 is expressed with a 6His tag at the N-terminus.
-
Species reactivity
Human
-
Origin
Escherichia coli
-
Peptide sequence
MGSSHHHHHHSSGLVPRGSHMSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQYTAFPLLAFLDGNPASSVEQASTTASSEVLSSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEAEASEATLFYLCELAPAPLDSDMPLLDS
-
Estimated molecular weight
15,9 kDa
-
Protein purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Endotoxin level
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
-
Shipping condition
Ambient/Room Temperature
-
Package form
Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2.
-
Storage conditions
Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
-
Reconstitution conditions
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 µg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
-
UniProt number
Q03933
-
-
Additional description
Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
-
Properties
Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Source
Recombinants or rec. proteins
-
Group
recombinants
-
Gene target
-
Gene symbol
HSF2
-
Short name
Recombinant Heat Shock Factor Protein 2/HSF2 (N-6His)
-
Technique
Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
-
Species
Human, Humans
-
Alternative name
Human HSF2(N-6His)
-
Alternative technique
rec
-
Gene info
MeSH Data
-
Name
-
Concept
Scope note:
The initial culturing of cells derived directly from fresh TISSUES.
-
Tree numbers
- E01.370.225.500.223.500
- E05.200.500.265.500
- E05.242.223.500
- E05.481.500.249.500
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products