Enolase, Neuron Specific (NSE) Monoclonal Antibody

  • Catalog number
    CAU29488-50ug
  • Price
    Please ask
  • Size
    50ug
  • Species Reactivity
    Human, Mouse
  • Estimated Turnaround Time
    6-11 business days
  • Clonality
    Monoclonal
  • Immunogen
    Ser2-Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
  • Application
    WB, IHC
  • Conjugation
    Unconjugated
  • Concentration
    1 mg/ml
  • Storage Temperature
    Enolase, Neuron Specific (NSE) Monoclonal Antibody should be stored at -20°C
  • Shelf life
    Use Enolase, Neuron Specific (NSE) Monoclonal Antibody before 1 year
  • Shipping Conditions
    Ice packs
  • Restriction
    For research use only. Not for diagnostic procedures.
  • Ordering
    To order Enolase, Neuron Specific (NSE) Monoclonal Antibody , please use the Cat. Nr. CAU29488 and submit your purchase order by email or by fax. A discount is available for larger or bulk quantities, please contact us for more information
  • Tips
    Our specialists recommend you to follow carefully the pre-registered instructions for Enolase, Neuron Specific (NSE) Monoclonal Antibody
  • Properties
    If you buy Antibodies supplied by Biomatik they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • About
    Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
  • French translation
    anticorps
  • Gene target
  • Short name
    Enolase, Neuron Specific (NSE) Monoclonal Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for, Monoclonals or monoclonal antibodies
  • Host
    Mouse
  • Alternative name
    Enolase, Neuron Specific (NSE) monoclonal (antibody to-)
  • Alternative technique
    antibodies
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee