Recombinant Horse Serum amyloid A protein(SAA1)

• Catalog number
  RPC20082
• Price
  Please ask
• Size
  1 mg

• Verified reactivity
  Equus caballus (Horse)
• Protein number
  P19857
• Gene number
  SAA1
• Other name
  Amyloid fibril protein AA
• Protein origin
  E.coli
• Protein region
  1-110aa
• Protein sequence
  LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY
• Information about sequence
  Full Length
• Expected molecular weight
  16.4kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Properties
  Horse (Equus ferus caballus) sera and plasma contain equine IgGs, Immunoglobulins. ELISA test are used to determine quantitatively the presence in horse serum of the antigen by a polyclonal antibody to the equine epitope selected for the ELISA kit. A blocking solution for the native horse or equine immunoglobulins in available in the ELISA protocol.
• Source
  Recombinants or rec. proteins
• Group
  recombinants, Sera
• Description
  Azide Free Serum for cell culture FBS fetal bovine serum. Filtered serum for sterility. The polyclonal serum contains no red or white blood cells or clotting factors; it is the blood plasma not including the fibrinogens. Serum includes all proteins and antibodies not used in blood clotting (coagulation) and all the electrolytes, antibodies, antigens, hormones, and any exogenous substances like drugs and microorganisms. Plasmas on request.
• About
  Serum should be stored at +5°C

• Gene target
  amyloid   protein   SAA1  
• Gene symbol
  SAA1
• Short name
  Recombinant amyloid A protein(SAA1)
• Technique
  Recombinant, serum, Immune serum prepared from the blood of a horse that has developed immunity to toxins. Because many people are sensitive to horse serum, a skin test for sensitivity is recommended before passive immunization with horse antibodies. Tetanus immune globulin prepared from human immune serum is preferred, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  Horse
• Label
  N-terminal 6xHis-tagged
• Species
  Horse, Horses
• Alternative name
  Rec. Horse blood serum amyloid A protein(serum amyloid A1)
• Alternative technique
  rec, sera
• Alternative to gene target
  serum amyloid A1, PIG4 and SAA and SAA2 and TP53I4, SAA1 and IDBG-34659 and ENSG00000173432 and 6288, heparin binding, Extracellular
• Tissue
  serum

Gene info

• Identity
  HGNC:10513
• Gene
  SAA1
• Long gene name
  serum amyloid A1
• Synonyms gene
  • SAA
• Synonyms
  • PIG4
  • TP53I4
• GenBank acession
  • M10906
• Locus
  11p15.1
• Discovery year
  1988-01-18
• Entrez gene record
  6288
• Pubmed identfication
  • 2595451
  • 9305847
• RefSeq identity
  • NM_199161
• Classification
  • Receptor ligands
• VEGA ID
  OTTHUMG00000166147

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products