Rabbit PLDN antibody
-
Catalog number70R-2858
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenPLDN antibody was raised using a synthetic peptide corresponding to a region with amino acids EGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTL
-
SpecificityNA
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PLDN antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolBLOC1S6
-
Short nameRabbit PLDN antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal PLDN antibody
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetbiogenesis of lysosomal organelles complex-1, subunit 6, pallidin, PLDN and IDBG-10516 and ENSG00000104164 and 26258, actin filament binding, Plasma membranes, Bloc1s6 and IDBG-203214 and ENSMUSG00000005804 and 18457, PLDN and IDBG-646689 and ENSBTAG00000012250 and 614408
-
Gene info
-
Identity
-
Gene
-
Long gene namebiogenesis of lysosomal organelles complex 1 subunit 6
-
Synonyms gene
-
Synonyms gene name
- pallid (mouse) homolog, pallidin
- pallidin homolog (mouse)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2000-01-21
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Biogenesis of lysosomal organelles complex 1 subunits
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data