Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

Recombinant Human C C Motif Chemokine 14 CXCL14

Recombinant Human C C Motif Chemokine 14 CXCL14 is available 4 times from Novo labs

C058-1000 | Recombinant Human C-X-C Motif Chemokine 14/CXCL14 size: 1 mg | 2,034.66 USD

Catalog number C058-1000
Supplier novo
Price 2,034.66 USD
Size 1 mg
Storage conditions Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at below -20°C for 3 months.
1. Gene info
Identity10640
GeneCXCL14
Synonyms gene
Synonyms gene name
  • small inducible cytokine subfamily B (Cys-X-Cys), member 14 (BRAK)
  • chemokine (C-X-C motif) ligand 14
Synonyms name
GenBank acession
Locus5q31.1
Discovery year1999-07-30
Pubmed identfication
RefSeq identity
Havana BLAST/BLATOTTHUMG00000129139
2. Gene info
Identity14013
GeneSMC4
Synonyms gene
Synonyms gene name
  • SMC4 (structural maintenance of chromosomes 4, yeast)-like 1
  • SMC4 structural maintenance of chromosomes 4-like 1 (yeast)
Synonyms
GenBank acession
Locus3q25.33
Discovery year2001-02-22
Pubmed identfication
Havana BLAST/BLATOTTHUMG00000159006
MeSH Data
Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
Product images
    #Human#.jpg

C058-10 | Recombinant Human C-X-C Motif Chemokine 14/CXCL14 size: 10 ug | 187.18 USD

Loading

C058-50 | Recombinant Human C-X-C Motif Chemokine 14/CXCL14 size: 50 ug | 449.69 USD

Loading

C058-500 | Recombinant Human C-X-C Motif Chemokine 14/CXCL14 size: 500 ug | 1,438.77 USD

Loading
Description Recombinant Human C-X-C Motif Chemokine 14 is produced by our E.coli expression system and the target gene encoding Ser35-Glu111 is expressed.
Species reactivity Human
Origin Escherichia coli
Peptide sequence SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE
Estimated molecular weight 9,4 kDa
Protein purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin level Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Shipping condition Ambient/Room Temperature
Package form Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5.
Reconstitution conditions See included datasheet or contact us for more information.
UniProt number O95715
Additional description Chemokines, chemokine receptors, ligands , motif chemokines and cytokines are supplied by novo in 1.
Properties Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
Source Recombinants or rec. proteins
Group recombinants
Gene targetC-X-C Motif Chemokine 14/CXCL14
Short name Recombinant C-X-C Motif Chemokine 14/CXCL14
Technique Recombinant
Species Human
Alternative name recombinant H. sapiens C-X-C Motif Chemokine 14/chemokine (C-X-C motif) ligand 14
Alternative technique rec
Alternative to gene target chemokine (C-X-C motif) ligand 14, BMAC and BRAK and KEC and KS1 and MIP-2g and MIP2G and NJAC and SCYB14, CXCL14 and IDBG-45673 and ENSG00000145824 and 9547, chemokine activity, Extracellular, Cxcl14 and IDBG-157150 and ENSMUSG00000021508 and 57266, CXCL14 and IDBG-645845 and ENSBTAG00000006694 and 511771
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
Recombinant Human C-X-C Motif Chemokine 14/CXCL14 size: 1 mg
Filters
+32-(0)1-658-90-45 [email protected]
  • C-X-C
  • Motif
  • Chemokine
  • 14/CXCL14
Back
Contact us
Ajax processing
Close
Chat with gentaur.com employee