Enolase, Neuron Specific (NSE) Monoclonal Antibody (Human, Mouse), FITC
-
Catalog number
MAA537Hu22-20ul-FITC
-
Price
Please ask
-
Size
20ul
-
-
Description
A Mouse monoclonal antibody against Human, Mouse Enolase, Neuron Specific (NSE). This antibody is labeled with FITC.
-
Specifications
Host: Mouse; Species Reactivity: Human, Mouse; Clonality: monoclonal; Tested applications: WB, IHC; Concentration: 1mg/mL; Isotype: IgG2b Kappa; Conjugation: FITC
-
Additional_information
Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT; Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
-
Storage_and_shipping
Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
-
Notes
Research Use Only.
-
Properties
If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C. This Cloud Clone Corp Fluorescein isothiocyanate (FITC) antibody is currently after some BD antibodies the most commonly used fluorescent dye for FACS. When excited at 488 nanometers, FITC has a green emission that's usually collected at 530 nanometers, the FL1 detector of a FACSCalibur or FACScan. FITC has a high quantum yield (efficiency of energy transfer from absorption to emission fluorescence) and approximately half of the absorbed photons are emitted as fluorescent light. For fluorescent microscopy applications, the 1 FITC is seldom used as it photo bleaches rather quickly though in flow cytometry applications, its photo bleaching effects are not observed due to a very brief interaction at the laser intercept. Cloud Clone Corp FITC is highly sensitive to pH extremes. Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
-
Conjugation
Anti-FITC Antibody
-
About
Monoclonals of this antigen are available in different clones. Each murine monoclonal anibody has his own affinity specific for the clone. Mouse monoclonal antibodies are purified protein A or G and can be conjugated to FITC for flow cytometry or FACS and can be of different isotypes.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus
-
French translation
anticorps
-
Gene target
-
Short name
Enolase, Neuron Specific (NSE) Monoclonal Antibody ( , Mouse), FITC
-
Technique
Antibody, Mouse, FITC, antibodies against human proteins, antibodies for, Fluorescein, Monoclonals or monoclonal antibodies, mouses
-
Host
mouse
-
Label
FITC
-
Species
Mouse, Humans, Mouses
-
Alternative name
Enolase, Neuron Specific (NSE) monoclonal (antibody to-) (H. sapiens, Mouse), fluorecein
-
Alternative technique
antibodies, murine, fluorescine
-
MeSH Data
-
Name
-
Concept
Scope note:
Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiers
ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products