Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

IL10R Alpha antibody

IL10R Alpha antibody is available 1 time from Fitzgerald labs

70R-1865 | IL10R Alpha antibody size: 100 µg | 446.18 USD

Loading
Category Primary Antibody
Tested for WB
Raised in Rabbit
Product Subtype Purified Polyclonal Antibodies
Antibody Subtype Polyclonal Antibodies, Purified
Method of Purification Total IgG Protein A purified
Specificity IL10R Alpha antibody was raised against the N terminal of IL10RA
Additional Information This is a rabbit polyclonal antibody against IL10RA, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at antibodies@fitzgerald-fii.com
Immunogen IL10R Alpha antibody was raised using the N terminal of IL10RA corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
Shipping Info Blue Ice
Shipping conditions Blue Ice
Assay Information IL10R Alpha Blocking Peptide, catalog no. 33R-3595, is also available for use as a blocking control in assays to test for specificity of this IL10R Alpha antibody
Applications WB
Research Area Cytokines & Growth Factors
Concentration 1 mg/ml
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IL10RA antibody in PBS
Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
Usage Recommendations WB: 5 ug/ml
Product Type Primary Antibodies
Type of Immunogen IL10R Alpha antibodies were raised using the N terminal of IL10RA corresponding to a region with amino acids GSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGN
Area of research Cytokines & Growth Factors
Cross Reactivity Human
Description The IL10R Alpha antibody is a α- or alpha protein sometimes glycoprotein present in blood.
Properties If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetIL10R Alpha
Short name IL10R Alpha antibody
Technique Antibody
Alternative name IL10R a (Antibody to)
Alternative technique antibodies
Similar products
HIF1 Alpha Mouse Monoclonal antibody Clone Halpha111a Suppplier: accurate-monoclonals
Price: 252.34 USD
IL10R alpha antibody Suppplier: MyBioSource
Price: 0.00 USD
Rabbit IL10R alpha antibody Suppplier: fitzgerald
Price: 430.13 USD
IL10R alpha antibody Suppplier: fitzgerald
Price: 375.07 USD
IL10R Alpha antibody Suppplier: MyBioSource
Price: 526.47 USD
Rabbit IL10R Alpha antibody Suppplier: fitzgerald
Price: 487.48 USD
Rabbit PKA alpha antibody Suppplier: fitzgerald
Price: 625.12 USD
Rabbit IL22 Receptor alpha 2 antibody Suppplier: fitzgerald
Price: 625.12 USD
Mouse alpha B Glycoprotein antibody Suppplier: fitzgerald
Price: 510.42 USD
Mouse anti-TNF-alpha autoantibody ELISA Kit Suppplier: MyBioSource
Price: 652.64 USD
alpha tubulin monoclonal antibody Suppplier: Exbio
Price: 138.79 USD
IL28R alpha antibody Suppplier: fitzgerald
Price: 544.83 USD
H K ATPase alpha subunit antibody Suppplier: MyBioSource
Price: 0.00 USD
Ask
Ajax processing
Close
IL10R Alpha antibody - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee