Rabbit NODAL antibody

• Catalog number
  70R-4026
• Price
  Please ask
• Size
  50 ug

• Applications
  WB
• Product Type
  Primary Antibodies
• Product Subtype
  Purified Polyclonal Antibodies
• Research Area
  Differentiation & Development
• Immunogen
  NODAL antibody was raised using a synthetic peptide corresponding to a region with amino acids EFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHH
• Specificity
  NA
• Cross Reactivity
  Human
• Clone
  NA
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NODAL antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping Info
  Blue Ice
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• About
  Rabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
• Latin name
  Oryctolagus cuniculus
• French translation
  anticorps

• Gene target
  NODAL  
• Gene symbol
  NODAL
• Short name
  Rabbit NODAL antibody
• Technique
  Antibody, Rabbit, antibodies against human proteins, antibodies for
• Host
  Rabbit, Rabbits
• Isotype
  NA
• Alternative name
  Rabbit polyclonal NODAL antibody
• Alternative technique
  antibodies, rabbit-anti
• Alternative to gene target
  nodal homolog (mouse), HTX5, NODAL and IDBG-77432 and ENSG00000156574 and 4838, type I activin receptor binding, Extracellular, Nodal and IDBG-155933 and ENSMUSG00000037171 and 18119, BT.88746 and IDBG-629699 and ENSBTAG00000013090 and 530748

Gene info

• Identity
  HGNC:7865
• Gene
  NODAL
• Long gene name
  nodal growth differentiation factor
• Synonyms gene name
  • nodal, mouse, homolog
  • nodal homolog (mouse)
• GenBank acession
  • BC033585
• Locus
  10q22.1
• Discovery year
  1998-06-05
• Entrez gene record
  4838
• Pubmed identfication
  • 9354794
• RefSeq identity
  • NM_018055
• Classification
  • Transforming growth factor beta superfamily
• VEGA ID
  OTTHUMG00000018408

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products