Estrogen-Related Receptor Gamma antibody

• Catalog number
  70R-2648
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Hormones & Steroids
• Type of Immunogen
  Estrogen-Related Receptor Gamma antibodies were raised using the N terminal of ESRRG corresponding to a region with amino acids TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
• Raised in
  Rabbit
• Specificity
  Estrogen-Related Receptor Gamma antibody was raised against the N terminal of ESRRG
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ESRRG antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  Estrogen-Related Receptor Gamma Blocking Peptide, catalog no. 33R-9206, is also available for use as a blocking control in assays to test for specificity of this Estrogen-Related Receptor Gamma antibody
• Additional Information
  This is a rabbit polyclonal antibody against ESRRG, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• French translation
  anticorps

• Gene target
  Estrogen-Related   Receptor   Gamma  
• Gene symbol
  ESRRG
• Short name
  Estrogen- Receptor Gamma antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal Estrogen-Related Receptor Gamma antibody raised against the N terminal of ESRRG
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:3474
• Gene
  ESRRG
• Long gene name
  estrogen related receptor gamma
• Synonyms
  • NR3B3
  • ERRg
  • ERR-gamma
• GenBank acession
  • AF058291
• Locus
  1q41
• Discovery year
  1998-02-17
• Entrez gene record
  2104
• Pubmed identfication
  • 9676434
  • 10072763
• RefSeq identity
  • NM_206595
• Classification
  • Estrogen related receptors
• VEGA ID
  OTTHUMG00000037025

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products