Recombinant Human Angiopoietin-like Protein 3/ANGPTL3 (C-6His)

• Catalog number
  CU43-500
• Price
  Please ask
• Size
  500 ug

• Description
  Recombinant Human Angiopoietin-related Protein 3 is produced by our expression system and the target gene encoding Ser17-Pro220 is expressed
• Species reactivity
  Human
• Origin
  Human cells
• Peptide sequence
  SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPHHHHHH
• Estimated molecular weight
  24.6
• Protein purity
  Greater than 95% as determined by reducing SDS-PAGE.
• Endotoxin level
  Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Shipping condition
  Ambient/Room Temperature
• Package form
  Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
• Storage conditions
  Lyophilized protein should be stored at below -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at below -20°C for 3 months.
• Reconstitution conditions
  See included datasheet or contact us for more information.
• UniProt number
  Q9Y5C1
• Other related products
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Angiopoietin-like   Protein   3/ANGPTL3   C-6His  
• Gene symbol
  ANGPTL3
• Short name
  Recombinant Angiopoietin-like Protein 3/ANGPTL3 (C-6His)
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Species
  Human, Humans
• Alternative name
  Recombinant Human Angiopoietin-like Protein 3/ANGPTL3 (17-220aa) (C-6His)
• Alternative technique
  rec
• Alternative to gene target
  angiopoietin-like 3, ANGPTL3 and IDBG-99367 and ENSG00000132855 and 27329, growth factor activity, Extracellular, Angptl3 and IDBG-166252 and ENSMUSG00000028553 and 30924, ANGPTL3 and IDBG-638594 and ENSBTAG00000021386 and 782603

Gene info

• Identity
  HGNC:491
• Gene
  ANGPTL3
• Long gene name
  angiopoietin like 3
• Synonyms gene
  • ANGPT5
• Synonyms gene name
  • angiopoietin-like 3
• Synonyms name
  • angiopoietin 5
• GenBank acession
  • AF152562
• Locus
  1p31.3
• Discovery year
  2000-02-07
• Entrez gene record
  27329
• Pubmed identfication
  • 10644446
• RefSeq identity
  • NM_014495
• Classification
  • Fibrinogen C domain containing
  • Receptor ligands
  • Angiopoietin like family
• VEGA ID
  OTTHUMG00000009146

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products