Rabbit TGF beta 2 antibody
-
Catalog number70R-6336
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCytokines & Growth Factors
-
ImmunogenTGF beta 2 antibody was raised using the middle region of TGFB2 corresponding to a region with amino acids NLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKT
-
SpecificityTGF beta 2 antibody was raised against the middle region of TGFB2
-
Cross ReactivityHuman
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TGFB2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolTAB2, CSRNP3
-
Short nameRabbit TGF beta 2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal TGF beta 2 antibody raised against the middle region of TGFB2
-
Alternative techniqueantibodies, rabbit-anti
-
Gene info
-
Identity
-
Gene
-
Long gene nameTGF-beta activated kinase 1 (MAP3K7) binding protein 2
-
Synonyms gene
-
Synonyms gene name
- mitogen-activated protein kinase kinase kinase 7 interacting protein 2
- TGF-beta activated kinase 1/MAP3K7 binding protein 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-02-22
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Zinc fingers RANBP2-type
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namecysteine and serine rich nuclear protein 3
-
Synonyms gene
-
Synonyms gene name
- family with sequence similarity 130, member A2
- cysteine-serine-rich nuclear protein 3
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2007-01-19
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Protein phosphatase 1 regulatory subunits
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data