Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

  • Catalog number
    RPC20571
  • Price
    Please ask
  • Size
    200 μg
  • Verified reactivity
    Mus musculus (Mouse)
  • Protein number
    Q64253
  • Gene number
    Ly6e
  • Other name
    Stem cell antigen 2; Thymic shared antigen 1
  • Protein origin
    E.coli
  • Protein region
    21-102aa
  • Protein sequence
    LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
  • Information about sequence
    Full Length
  • Expected molecular weight
    25.82kD
  • Protein purity
    ≥ 90%
  • Storage recommendation
    Aliquot and store at -20°C. Minimize freezing and thawing.
  • Use before
    1 year
  • Shipping requirements
    Blue ice
  • Estimated production time
    7-11 business days
  • Notes
    For research use only. Not for diagnostic procedures.
  • Description
    Antigens are peptides or recombinant or native dependent on the production method.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Source
    Recombinants or rec. proteins
  • Group
    recombinants
  • Gene target
  • Short name
    Recombinant Mouse Lymphocyte antigen 6E(Ly6e)
  • Technique
    Recombinant, antigen, Mouse, antigenes, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
  • Host
    mouse
  • Label
    N-terminal 6xHis-B2M-tagged
  • Species
    Mouse, Mouses
  • Alternative name
    Rec. Mouse Lymphocyte protein 6E(lymphocyte antigen 6 complex, locus E)
  • Alternative technique
    rec, antigenes, murine
  • Alternative to gene target
    lymphocyte antigen 6 complex, locus E, RIG-E and RIGE and SCA-2 and SCA2 and TSA-1, LY6E and IDBG-38103 and ENSG00000160932 and 4061, Plasma membranes, Ly6e and IDBG-150534 and ENSMUSG00000022587 and 17069, LY6E and IDBG-643844 and ENSBTAG00000017040 and 510977
  • Tissue
    lymphocyte
MeSH Data
  • Name
  • Concept
    Scope note: The initial culturing of cells derived directly from fresh TISSUES.
  • Tree numbers
    • E01.370.225.500.223.500
    • E05.200.500.265.500
    • E05.242.223.500
    • E05.481.500.249.500
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee