Recombinant Mouse Sushi repeat-containing protein SRPX2(Srpx2)

• Catalog number
  RPC20481
• Price
  Please ask
• Size
  200 μg

• Verified reactivity
  Mus musculus (Mouse)
• Protein number
  Q8R054
• Gene number
  Srpx2
• Other name
  no alternative name
• Protein origin
  E.coli
• Protein region
  26-468aa
• Protein sequence
  WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE
• Information about sequence
  Full Length of Mature Protein
• Expected molecular weight
  69.17kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Test
  Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
• Latin name
  Mus musculus
• Source
  Recombinants or rec. proteins
• Group
  recombinants

• Gene target
  Sushi   repeat   protein   SRPX2   Srpx2  
• Gene symbol
  SRPX2
• Short name
  Recombinant Mouse Sushi repeat- protein SRPX2(Srpx2)
• Technique
  Recombinant, Mouse, mouses, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Host
  mouse
• Species
  Mouse, Mouses
• Alternative name
  Rec. Mouse Sushi repeat-containing protein sushi-repeat containing protein, X-linked 2(sushi-repeat containing protein, X-linked 2)
• Alternative technique
  rec, murine
• Alternative to gene target
  sushi-repeat containing protein, X-linked 2, SRPX2 and IDBG-79192 and ENSG00000102359 and 27286, identical protein binding, Extracellular, Srpx2 and IDBG-170434 and ENSMUSG00000031253 and 68792, SRPX2 and IDBG-633212 and ENSBTAG00000037686 and 101908743,514742

Gene info

• Identity
  HGNC:30668
• Gene
  SRPX2
• Long gene name
  sushi repeat containing protein X-linked 2
• Synonyms gene name
  • sushi-repeat-containing protein, X-linked 2
• Synonyms
  • SRPUL
• GenBank acession
  • AF393649
• Locus
  Xq22.1
• Discovery year
  2004-06-25
• Entrez gene record
  27286
• Pubmed identfication
  • 9864177
• RefSeq identity
  • NM_014467
• Classification
  • Sushi domain containing
• VEGA ID
  OTTHUMG00000022003
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products