Rabbit SPON2 antibody
-
Catalog number70R-6084
-
PricePlease ask
-
Size50 ug
-
-
ApplicationsWB
-
Product TypePrimary Antibodies
-
Product SubtypePurified Polyclonal Antibodies
-
Research AreaCell Biology
-
ImmunogenSPON2 antibody was raised using the middle region of SPON2 corresponding to a region with amino acids GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV
-
SpecificitySPON2 antibody was raised against the middle region of SPON2
-
Cross ReactivityHuman,Mouse,Rat
-
CloneNA
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SPON2 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping InfoBlue Ice
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
AboutRabbits are used for polyclonal antibody production by fitzgerald. Rabbit antibodies are very stable and can be stored for several days at room temperature. fitzgerald adds sodium azide and glycerol to enhance the stability of the rabbit polyclonal antibodies. Anti-human, anti mouse antibodies to highly immunogenic selected peptide sequences are" monoclonal like" since the epitope to which they are directed is less than 35 amino acids long.
-
Latin nameOryctolagus cuniculus
-
French translationanticorps
-
Gene target
-
Gene symbolSPON2
-
Short nameRabbit SPON2 antibody
-
TechniqueAntibody, Rabbit, antibodies against human proteins, antibodies for
-
HostRabbit, Rabbits
-
IsotypeNA
-
Alternative nameRabbit polyclonal SPON2 antibody raised against the middle region of SPON2
-
Alternative techniqueantibodies, rabbit-anti
-
Alternative to gene targetspondin 2, extracellular matrix protein, DIL-1 and DIL1 and M-SPONDIN and MINDIN, SPON2 and IDBG-6462 and ENSG00000159674 and 100130872,10417, metal ion binding, Extracellular, Spon2 and IDBG-152784 and ENSMUSG00000037379 and 100689, BT.18280 and IDBG-643872 and ENSBTAG00000004261 and 513844
-
Gene info
-
Identity
-
Gene
-
Long gene namespondin 2
-
Synonyms gene name
- spondin 2, extracellular matrix protein
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-06-18
-
Entrez gene record
-
Pubmed identfication
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data