Recombinant Human Renin receptor

#

• Catalog number
  RPC20578
• Price:

  Please ask

  Ask for price
• Size
  1 mg

# #

• Verified reactivity
  Homo sapiens (Human)
• Protein number
  O75787
• Gene number
  ATP6AP2
• Other name
  ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ER-localized type I transmembrane adaptor; Embryonic liver differentiation factor 10; N14F; Renin/prorenin receptor; Vacuolar ATP synthase membrane sector-associated protein M8-9
• Protein origin
  E.coli
• Protein region
  17-350aa
• Protein sequence
  NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
• Information about sequence
  Full Length
• Expected molecular weight
  41.43kDa
• Protein purity
  ≥ 90%
• Storage recommendation
  Aliquot and store at -20°C. Minimize freezing and thawing.
• Use before
  1 year
• Shipping requirements
  Blue ice
• Estimated production time
  7-11 business days
• Notes
  For research use only. Not for diagnostic procedures.
• Hyperlink
• Properties
  Human proteins, cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies. Modern humans (Homo sapiens, primarily ssp. Homo sapiens sapiens). Depending on the epitopes used human ELISA kits can be cross reactive to many other species. Mainly analyzed are human serum, plasma, urine, saliva, human cell culture supernatants and biological samples.
• Description
  The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
• Source
  Recombinants or rec. proteins
• Group
  recombinants

#

• Gene target
  Renin   receptor  
• Gene symbol
  ATP6AP2
• Short name
  Recombinant Renin receptor
• Technique
  Recombinant, E. coli recombinant proteins are genetic recombinations in Escherichia coli, supplied as white sterile powder lyopillized. bioma advises they will be reconstituted in a buffer soluion or culture medium for cell culture.
• Label
  N-terminal 6xHis-tagged
• Species
  Human, Humans
• Alternative name
  Rec. H. sapiens Renin receptor
• Alternative technique
  rec

Gene info

• Identity
  HGNC:18305
• Gene
  ATP6AP2
• Long gene name
  ATPase H+ transporting accessory protein 2
• Synonyms gene
  • ATP6IP2
• Synonyms gene name
  • ATPase, H+ transporting, lysosomal interacting protein 2
  • ATPase, H+ transporting, lysosomal accessory protein 2
• Synonyms
  • M8-9
  • APT6M8-9
  • ATP6M8-9
  • PRR
  • RENR
• Synonyms name
  • prorenin receptor
  • renin receptor
  • V-ATPase M8.9 subunit
• GenBank acession
  • AF248966
• Locus
  Xp11.4
• Discovery year
  2002-05-23
• Entrez gene record
  10159
• Pubmed identfication
  • 9556572
  • 11590366
• RefSeq identity
  • NM_005765
• VEGA ID
  OTTHUMG00000024103
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Primary Cell Culture
• Concept
  Scope note: The initial culturing of cells derived directly from fresh TISSUES.
• Tree numbers
  • E01.370.225.500.223.500
  • E05.200.500.265.500
  • E05.242.223.500
  • E05.481.500.249.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Product images

Similar products