Filters
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing
Ajax processing

NEDD8 Antibody

NEDD8 Antibody is available 1 time from Boster labs

A00547 | NEDD8 Antibody size: 0,1 mg | 428.98 USD

Loading
Clonality Polyclonal antibody
Entrez GeneID 4738
Analyses WB,IHC-P
Related articles 1. Bohnsack, R. N., Haas, A. L. Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer. J. Biol. Chem. 278: 26823-26830, 2003. 2. Cope, G. A., Suh, G. S. B., Aravind, L., Schwarz, S. E., Zipursky, S. L., Koonin, E. V., Deshaies, R. J. Role of predicted metalloprotease motif of Jab1/Csn5 in cleavage of Nedd8 from Cul1. Science 298: 608-611, 2002. 3. Cui, J., Yao, Q., Li, S., Ding, X., Lu, Q., Mao, H., Liu, L., Zheng, N., Chen, S., Shao, F. Glutamine deamidation and dysfunction of ubiquitin/NEDD8 induced by a bacterial effector family. Science 329: 1215-1218, 2010.
Raised in rabbit
Solubilization The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
Target antigen NEDD8
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human NEDD8 (20-60aa TDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK), identical to the related mouse and rat sequences.
Type of the antibody IgG polyclonal antibody
Uniprot ID Q15843
Clone Polyclonal antibody
Protein Name NEDD8
Synonyms NED8 | NEDD 8 | NEDD-8 | Nedd8 | Neddylin | Rub1 | Q15843
Storage condtions Keep the NEDD8 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
Purification Immunogen affinity purified.
Background NEDD8 is a protein that in humans is encoded by the NEDD8 gene. Human NEDD8 shares 60% amino acid sequence identity to ubiquitin. The most substrates of NEDD8 modification are the Cullin subunits of Cullin-based E3 ubiquitin ligases, which are active only when neddylated. Their NEDDylation is critical for the recruitment of E2 to the ligase complex, thus facilitating ubiquitin conjugation. NEDD8 modification has therefore been implicated in cell cycle progression and cytoskeletal regulation.
Product form freeze-dried
Gene Name NEDD8
Gene Full Name neural precursor cell expressed, developmentally down-regulated 8
Product configuration Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reacts with species: human, mouse, rat
Tips The NEDD8 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
Properties If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
French translation anticorps
Gene targetNEDD8
Short name NEDD8 Antibody
Technique Antibody
Alternative name NEDD8 (Antibody to)
Alternative technique antibodies
Similar products
No similar products groups has been found
Ask
Ajax processing
Close
NEDD8 Antibody from boster - Gentaur.com
Filters
+32-(0)1-658-90-45 lieven@gentaur.com
Contact us
Ajax processing
Close
Chat with gentaur.com employee